PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Csa14g044410.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Camelina
Family HD-ZIP
Protein Properties Length: 716aa    MW: 80851.7 Da    PI: 6.7448
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Csa14g044410.1genomeCSGPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox597.8e-192981456
                    -SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
        Homeobox  4 RttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56
                     + ++++q+++Lee+F+++++p+  +r++LA++l+L+ +q+k+WFqN+R++ k
  Csa14g044410.1 29 HQHHSNHQIHRLEEYFNECPHPDDLQRRRLAEELNLKPKQIKFWFQNKRTQVK 81
                    56789********************************************9876 PP

2START103.24.4e-332374592206
                     HHHHHHHHHHHHHHHC-TT-EEEE........EXCCTTEEEEE..EESSS.SCEEEEEEEECCSCHHHHHHHHHCCCGGCT-TT-S....EEEEE CS
           START   2 laeeaaqelvkkalaeepgWvkss........esengdevlqk..feeskvdsgealrasgvvdmvlallveellddkeqWdetla....kaetl 82 
                     +a +a +e++++ + ee +W kss         ++++++++++  f+++   + e +++++vv m++++lv  ++d+  +W + ++    +a+tl
  Csa14g044410.1 237 MAAKAVAEVMSLSKMEESVWIKSSidgrlvidPGNYEKISTKInhFKSTS-VRPESSKEVVVVQMDATNLVDMFFDTE-KWARLFPtivnEAKTL 329
                     57789999*********************996444444443331144444.48899**********************.9999999999977777 PP

                     EEECTT.....EEEEEEEEXXTTXX-SSX.EEEEEEEEEEE.TTS-EEEEEEEEE-TTS--.-TTSEE-EESSEEEEEEEECTCEEEEEEEE-EE CS
           START  83 evissg.....galqlmvaelqalsplvp.RdfvfvRyirqlgagdwvivdvSvdseqkppesssvvRaellpSgiliepksnghskvtwvehvd 171
                      v++s      ++  +++ +   lsplvp R f ++R+++q +++ w+i+dvS   ++    +     ++++pSg li+ ++ g+skvtw+ehv+
  Csa14g044410.1 330 HVLDSIdhgrqTFSKVIYEQEHILSPLVPpRQFIILRSCQQVEEDLWMIADVSCHLPNVEL-DFTAPLCTKRPSGVLIQALPHGGSKVTWIEHVE 423
                     776665566*988899999999999****************************88887765.56666699************************* PP

                     --SSXX.HHHHHHHHHHHHHHHHHHHHHHTXXXXXX CS
           START 172 lkgrlp.hwllrslvksglaegaktwvatlqrqcek 206
                     +++++  h l++ l+ sg   ga++w+ tl+r ce+
  Csa14g044410.1 424 VNDNVRpHRLYKDLLYSGFGYGARRWTVTLERMCER 459
                     ****955***************************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466894.18E-171383IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.605.1E-181584IPR009057Homeodomain-like
PROSITE profilePS5007116.3422383IPR001356Homeobox domain
SMARTSM003893.2E-172587IPR001356Homeobox domain
CDDcd000861.84E-162684No hitNo description
PfamPF000463.7E-163081IPR001356Homeobox domain
PROSITE patternPS0002705881IPR017970Homeobox, conserved site
PROSITE profilePS5084842.123227462IPR002913START domain
CDDcd088751.35E-85231458No hitNo description
SuperFamilySSF559617.99E-26231460No hitNo description
SMARTSM002341.6E-15236459IPR002913START domain
PfamPF018526.2E-27238459IPR002913START domain
Gene3DG3DSA:3.30.530.206.0E-6292425IPR023393START-like domain
SuperFamilySSF559616.87E-9482682No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0008289Molecular Functionlipid binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 716 aa     Download sequence    Send to blast
MVSSRDDTSI DERGTTSMET NDNQERSNHQ HHSNHQIHRL EEYFNECPHP DDLQRRRLAE  60
ELNLKPKQIK FWFQNKRTQV KIQNEKAENA ELRIDNLKMK CENEAMEEAL KTVVCPPCGG  120
RHPGRKEQLL YLQNLRAENA FLEIERERLS SYVSQHRGHS IRSVDALPYL HGPSTFNNRP  180
ASYGTSYNHL PTQSSLLRGP YTRENINVTP QPKPQNSVLL QHLQALSQPE KTVMFEMAAK  240
AVAEVMSLSK MEESVWIKSS IDGRLVIDPG NYEKISTKIN HFKSTSVRPE SSKEVVVVQM  300
DATNLVDMFF DTEKWARLFP TIVNEAKTLH VLDSIDHGRQ TFSKVIYEQE HILSPLVPPR  360
QFIILRSCQQ VEEDLWMIAD VSCHLPNVEL DFTAPLCTKR PSGVLIQALP HGGSKVTWIE  420
HVEVNDNVRP HRLYKDLLYS GFGYGARRWT VTLERMCERL SLYSMSDFPS TDHAGVVKTI  480
EGRRSVMNLG ERMLKNFAWI MKMSDKHDFS QQCDTNNSGV RISVRTNIEA GQPTGLIVCA  540
SSSLYLPLTP LRVYDFLSNL EVRHQWDVLC HGNPATEAAR FVTGSNQKNN VTFLKPSSGG  600
ENSELMILQD GFIDALGGMF VYAPVDLNTA YSAISGQVDP STIPVLPSGF IISRDSRPSV  660
GELDSERMTL LTVAFQILVS GSSQSTNLNL EDSATTVHIL ISSTVQRVKA MLNCE*
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010461278.10.0PREDICTED: homeobox-leucine zipper protein HDG10-like
SwissprotQ9S9Z00.0HDG10_ARATH; Homeobox-leucine zipper protein HDG10
TrEMBLR0GL000.0R0GL00_9BRAS; Uncharacterized protein
STRINGAT1G34650.10.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM84681531
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G34650.10.0homeodomain GLABROUS 10